Lineage for d2dqrb_ (2dqr B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982415Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
    automatically mapped to Pfam PF02334
  6. 1982416Protein Replication terminator protein (RTP) [46808] (1 species)
    contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer
  7. 1982417Species Bacillus subtilis [TaxId:1423] [46809] (7 PDB entries)
  8. 1982425Domain d2dqrb_: 2dqr B: [241642]
    automated match to d1bm9a_
    mutant

Details for d2dqrb_

PDB Entry: 2dqr (more details), 3.01 Å

PDB Description: crystal structure of the replication terminator protein mutant rtp.e39k.r42q
PDB Compounds: (B:) Replication termination protein

SCOPe Domain Sequences for d2dqrb_:

Sequence, based on SEQRES records: (download)

>d2dqrb_ a.4.5.7 (B:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
stgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhelldd
gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf

Sequence, based on observed residues (ATOM records): (download)

>d2dqrb_ a.4.5.7 (B:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
stgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhelldd
gilkqikvkkegqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf

SCOPe Domain Coordinates for d2dqrb_:

Click to download the PDB-style file with coordinates for d2dqrb_.
(The format of our PDB-style files is described here.)

Timeline for d2dqrb_: