SCOPe 2.07: Domain d2doqc_: 2doq C:

Lineage for d2doqc_ (2doq C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255121] (3 PDB entries)

8. Domain d2doqc_: 2doq C: [241640]
   automated match to d2mysb_
   complexed with ca

Details for d2doqc_

PDB Entry: 2doq, 3 Å

PDB Description: crystal structure of sfi1p/cdc31p complex

PDB Compounds: (C:) Cell division control protein 31

SCOPe Domain Sequences for d2doqc_:

Sequence, based on SEQRES records:

>d2doqc_ a.39.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydsegr
hlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltdee
lramieefdldgdgeinenefiai

Sequence, based on observed residues (ATOM records):

>d2doqc_ a.39.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydsegr
hlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgamieefd
ldnenefiai

Timeline for d2doqc_:

• d2doqc_ first appeared in SCOPe 2.04
  
• d2doqc_ appears in SCOPe 2.06
  
• d2doqc_ appears in the current release, SCOPe 2.08