SCOPe 2.08: Domain d2doca1: 2doc A:8-113

Lineage for d2doca1 (2doc A:8-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d2doca1: 2doc A:8-113 [241637]
   Other proteins in same PDB: d2doca2, d2doca3
   automated match to d1uema_

Details for d2doca1

PDB Entry: 2doc

PDB Description: solution structure of the fibronectin type-iii domain of human neural cell adhesion molecule 2

PDB Compounds: (A:) Neural cell adhesion molecule 2

SCOPe Domain Sequences for d2doca1:

Sequence; same for both SEQRES and ATOM records:

>d2doca1 b.1.2.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeyilaladvpsspygvkiielsqttakvsfnkpdshggvpihhyqvdvkevaseiwkiv
rshgvqtmvvlnnlepnttyeirvaavngkgqgdyskieifqtlpv

Timeline for d2doca1:

• d2doca1 first appeared in SCOPe 2.04, called d2doca_
  
• d2doca1 appears in SCOPe 2.07