![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries) |
![]() | Domain d2do4a1: 2do4 A:791-877 [241636] Other proteins in same PDB: d2do4a2, d2do4a3 automated match to d1x4aa1 |
PDB Entry: 2do4 (more details)
SCOPe Domain Sequences for d2do4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2do4a1 d.58.7.0 (A:791-877) automated matches {Human (Homo sapiens) [TaxId: 9606]} vfrystslekhklfisglpfsctkeeleeickahgtvkdlrlvtnragkpkglayveyen esqasqavmkmdgmtikeniikvaisn
Timeline for d2do4a1: