Lineage for d2do4a1 (2do4 A:791-877)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2559336Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2559337Protein automated matches [190896] (11 species)
    not a true protein
  7. 2559375Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)
  8. 2559520Domain d2do4a1: 2do4 A:791-877 [241636]
    Other proteins in same PDB: d2do4a2, d2do4a3
    automated match to d1x4aa1

Details for d2do4a1

PDB Entry: 2do4 (more details)

PDB Description: solution structure of the rna binding domain of squamous cell carcinoma antigen recognized by t cells 3
PDB Compounds: (A:) Squamous cell carcinoma antigen recognized by T-cells 3

SCOPe Domain Sequences for d2do4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2do4a1 d.58.7.0 (A:791-877) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vfrystslekhklfisglpfsctkeeleeickahgtvkdlrlvtnragkpkglayveyen
esqasqavmkmdgmtikeniikvaisn

SCOPe Domain Coordinates for d2do4a1:

Click to download the PDB-style file with coordinates for d2do4a1.
(The format of our PDB-style files is described here.)

Timeline for d2do4a1: