| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
| Protein RNA binding protein 23 [143352] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [143353] (2 PDB entries) Uniprot Q86U06 148-248 |
| Domain d2dnza_: 2dnz A: [241635] automated match to d1x5sa1 |
PDB Entry: 2dnz (more details)
SCOPe Domain Sequences for d2dnza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dnza_ d.58.7.1 (A:) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}
gssgssglyvgslhfnitedmlrgifepfgkidnivlmkdsdtgrskgygfitfsdseca
rraleqlngfelagrpmrvghvterldggsgpssg
Timeline for d2dnza_: