Lineage for d2dnza1 (2dnz A:231-312)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952115Protein RNA binding protein 23 [143352] (1 species)
  7. 2952116Species Human (Homo sapiens) [TaxId:9606] [143353] (2 PDB entries)
    Uniprot Q86U06 148-248
  8. 2952117Domain d2dnza1: 2dnz A:231-312 [241635]
    Other proteins in same PDB: d2dnza2, d2dnza3
    automated match to d1x5sa1

Details for d2dnza1

PDB Entry: 2dnz (more details)

PDB Description: solution structure of the second rna binding domain of rna binding motif protein 23
PDB Compounds: (A:) Probable RNA-binding protein 23

SCOPe Domain Sequences for d2dnza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dnza1 d.58.7.1 (A:231-312) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}
lyvgslhfnitedmlrgifepfgkidnivlmkdsdtgrskgygfitfsdsecarraleql
ngfelagrpmrvghvterldgg

SCOPe Domain Coordinates for d2dnza1:

Click to download the PDB-style file with coordinates for d2dnza1.
(The format of our PDB-style files is described here.)

Timeline for d2dnza1: