Lineage for d2dn9a1 (2dn9 A:8-73)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979943Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 1979979Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 1979980Protein automated matches [190750] (7 species)
    not a true protein
  7. 1979990Species Human (Homo sapiens) [TaxId:9606] [255094] (9 PDB entries)
  8. 1979995Domain d2dn9a1: 2dn9 A:8-73 [241621]
    Other proteins in same PDB: d2dn9a2, d2dn9a3
    automated match to d1wjza_

Details for d2dn9a1

PDB Entry: 2dn9 (more details)

PDB Description: solution structure of j-domain from the dnaj homolog, human tid1 protein
PDB Compounds: (A:) DnaJ homolog subfamily A member 3

SCOPe Domain Sequences for d2dn9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dn9a1 a.2.3.0 (A:8-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dyyqilgvprnasqkeikkayyqlakkyhpdtnkddpkakekfsqlaeayevlsdevkrk
qydayg

SCOPe Domain Coordinates for d2dn9a1:

Click to download the PDB-style file with coordinates for d2dn9a1.
(The format of our PDB-style files is described here.)

Timeline for d2dn9a1: