SCOPe 2.05: Domain d2dn9a_: 2dn9 A:

Lineage for d2dn9a_ (2dn9 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255094] (9 PDB entries)

8. Domain d2dn9a_: 2dn9 A: [241621]
   automated match to d1wjza_

Details for d2dn9a_

PDB Entry: 2dn9

PDB Description: solution structure of j-domain from the dnaj homolog, human tid1 protein

PDB Compounds: (A:) DnaJ homolog subfamily A member 3

SCOPe Domain Sequences for d2dn9a_:

Sequence; same for both SEQRES and ATOM records:

>d2dn9a_ a.2.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgdyyqilgvprnasqkeikkayyqlakkyhpdtnkddpkakekfsqlaeayevl
sdevkrkqydaygsgpssg

Timeline for d2dn9a_:

• d2dn9a_ first appeared in SCOPe 2.04
  
• d2dn9a_ is called d2dn9a1 in SCOPe 2.06
  
• d2dn9a_ appears in the current release, SCOPe 2.08, called d2dn9a1