Class a: All alpha proteins [46456] (286 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.3: Chaperone J-domain [46565] (2 families) |
Family a.2.3.0: automated matches [191473] (1 protein) not a true family |
Protein automated matches [190750] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255094] (9 PDB entries) |
Domain d2dn9a_: 2dn9 A: [241621] automated match to d1wjza_ |
PDB Entry: 2dn9 (more details)
SCOPe Domain Sequences for d2dn9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dn9a_ a.2.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgdyyqilgvprnasqkeikkayyqlakkyhpdtnkddpkakekfsqlaeayevl sdevkrkqydaygsgpssg
Timeline for d2dn9a_: