Lineage for d2dn0a_ (2dn0 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1721270Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1721271Protein automated matches [190674] (16 species)
    not a true protein
  7. 1721306Species Human (Homo sapiens) [TaxId:9606] [189258] (22 PDB entries)
  8. 1721326Domain d2dn0a_: 2dn0 A: [241617]
    automated match to d2ecca1

Details for d2dn0a_

PDB Entry: 2dn0 (more details)

PDB Description: solution structure of the second homeobox domain of human zinc fingers and homeoboxes protein 3
PDB Compounds: (A:) Zinc fingers and homeoboxes protein 3

SCOPe Domain Sequences for d2dn0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dn0a_ a.4.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgasiyknkksheqlsalkgsfcrnqfpgqsevehltkvtglstrevrkwfsdrr
yhcrnlkgsrsgpssg

SCOPe Domain Coordinates for d2dn0a_:

Click to download the PDB-style file with coordinates for d2dn0a_.
(The format of our PDB-style files is described here.)

Timeline for d2dn0a_: