SCOPe 2.04: Domain d2dn0a_: 2dn0 A:

Lineage for d2dn0a_ (2dn0 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189258] (20 PDB entries)

8. Domain d2dn0a_: 2dn0 A: [241617]
   automated match to d2ecca1

Details for d2dn0a_

PDB Entry: 2dn0

PDB Description: solution structure of the second homeobox domain of human zinc fingers and homeoboxes protein 3

PDB Compounds: (A:) Zinc fingers and homeoboxes protein 3

SCOPe Domain Sequences for d2dn0a_:

Sequence; same for both SEQRES and ATOM records:

>d2dn0a_ a.4.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgasiyknkksheqlsalkgsfcrnqfpgqsevehltkvtglstrevrkwfsdrr
yhcrnlkgsrsgpssg

Timeline for d2dn0a_:

• d2dn0a_ is new in SCOPe 2.04-stable
  
• d2dn0a_ appears in SCOPe 2.05
  
• d2dn0a_ appears in the current release, SCOPe 2.08, called d2dn0a1