SCOPe 2.08: Domain d2dmxa1: 2dmx A:8-86

Lineage for d2dmxa1 (2dmx A:8-86)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255094] (10 PDB entries)

8. Domain d2dmxa1: 2dmx A:8-86 [241616]
   Other proteins in same PDB: d2dmxa2, d2dmxa3
   automated match to d1bqza_

Details for d2dmxa1

PDB Entry: 2dmx

PDB Description: solution structure of the j domain of dnaj homolog subfamily b member 8

PDB Compounds: (A:) DnaJ homolog subfamily B member 8

SCOPe Domain Sequences for d2dmxa1:

Sequence; same for both SEQRES and ATOM records:

>d2dmxa1 a.2.3.0 (A:8-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
manyyevlgvqasaspedikkayrklalrwhpdknpdnkeeaekkfklvseayevlsdsk
krslydragcdswraggga

Timeline for d2dmxa1:

• d2dmxa1 first appeared in SCOPe 2.04, called d2dmxa_
  
• d2dmxa1 appears in SCOPe 2.07