Lineage for d2dmua_ (2dmu A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1478383Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1478384Protein automated matches [190674] (14 species)
    not a true protein
  7. 1478409Species Human (Homo sapiens) [TaxId:9606] [189258] (20 PDB entries)
  8. 1478417Domain d2dmua_: 2dmu A: [241615]
    automated match to d1nk2p_

Details for d2dmua_

PDB Entry: 2dmu (more details)

PDB Description: solution structure of the homeobox domain of homeobox protein goosecoid
PDB Compounds: (A:) Homeobox protein goosecoid

SCOPe Domain Sequences for d2dmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dmua_ a.4.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgrrhrtiftdeqlealenlfqetkypdvgtreqlarkvhlreekvevwfknrra
kwrrsgpssg

SCOPe Domain Coordinates for d2dmua_:

Click to download the PDB-style file with coordinates for d2dmua_.
(The format of our PDB-style files is described here.)

Timeline for d2dmua_: