![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (25 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries) |
![]() | Domain d2dmua1: 2dmu A:8-64 [241615] Other proteins in same PDB: d2dmua2, d2dmua3 automated match to d1nk2p_ |
PDB Entry: 2dmu (more details)
SCOPe Domain Sequences for d2dmua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dmua1 a.4.1.0 (A:8-64) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrhrtiftdeqlealenlfqetkypdvgtreqlarkvhlreekvevwfknrrakwrr
Timeline for d2dmua1: