Lineage for d2dmta1 (2dmt A:8-74)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306215Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries)
  8. 2306240Domain d2dmta1: 2dmt A:8-74 [241614]
    Other proteins in same PDB: d2dmta2, d2dmta3
    automated match to d1nk2p_

Details for d2dmta1

PDB Entry: 2dmt (more details)

PDB Description: solution structure of the homeobox domain of homeobox protein barh- like 1
PDB Compounds: (A:) Homeobox protein BarH-like 1

SCOPe Domain Sequences for d2dmta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dmta1 a.4.1.0 (A:8-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gepgtkakkgrrsrtvftelqlmglekrfekqkylstpdridlaeslglsqlqvktwyqn
rrmkwkk

SCOPe Domain Coordinates for d2dmta1:

Click to download the PDB-style file with coordinates for d2dmta1.
(The format of our PDB-style files is described here.)

Timeline for d2dmta1: