SCOPe 2.04: Domain d2dmsa_: 2dms A:

Lineage for d2dmsa_ (2dms A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188321] (5 PDB entries)

8. Domain d2dmsa_: 2dms A: [241613]
   automated match to d3lnqa_

Details for d2dmsa_

PDB Entry: 2dms

PDB Description: solution structure of the homeobox domain of homeobox protein otx2

PDB Compounds: (A:) Homeobox protein OTX2

SCOPe Domain Sequences for d2dmsa_:

Sequence; same for both SEQRES and ATOM records:

>d2dmsa_ a.4.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgrrerttftraqldvlealfaktrypdifmreevalkinlpesrvqvwfknrra
kcrqqqqqqqnggqsgpssg

Timeline for d2dmsa_:

• d2dmsa_ is new in SCOPe 2.04-stable
  
• d2dmsa_ appears in SCOPe 2.05
  
• d2dmsa_ appears in the current release, SCOPe 2.08, called d2dmsa1