| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
| Protein automated matches [190674] (25 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188321] (5 PDB entries) |
| Domain d2dmsa1: 2dms A:8-74 [241613] Other proteins in same PDB: d2dmsa2, d2dmsa3 automated match to d3lnqa_ |
PDB Entry: 2dms (more details)
SCOPe Domain Sequences for d2dmsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dmsa1 a.4.1.0 (A:8-74) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rrerttftraqldvlealfaktrypdifmreevalkinlpesrvqvwfknrrakcrqqqq
qqqnggq
Timeline for d2dmsa1: