Lineage for d2dmqa1 (2dmq A:8-74)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692777Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries)
  8. 2692798Domain d2dmqa1: 2dmq A:8-74 [241612]
    Other proteins in same PDB: d2dmqa2, d2dmqa3
    automated match to d2ecca1

Details for d2dmqa1

PDB Entry: 2dmq (more details)

PDB Description: solution structure of the homeobox domain of lim/homeobox protein lhx9
PDB Compounds: (A:) LIM/homeobox protein Lhx9

SCOPe Domain Sequences for d2dmqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dmqa1 a.4.1.0 (A:8-74) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krmrtsfkhhqlrtmksyfainhnpdakdlkqlaqktgltkrvlqvwfqnarakfrrnll
rqenggv

SCOPe Domain Coordinates for d2dmqa1:

Click to download the PDB-style file with coordinates for d2dmqa1.
(The format of our PDB-style files is described here.)

Timeline for d2dmqa1: