![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein p67phox [74922] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74923] (3 PDB entries) |
![]() | Domain d2dmoa1: 2dmo A:8-62 [241611] Other proteins in same PDB: d2dmoa2, d2dmoa3 automated match to d1ue9a_ |
PDB Entry: 2dmo (more details)
SCOPe Domain Sequences for d2dmoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dmoa1 b.34.2.1 (A:8-62) p67phox {Human (Homo sapiens) [TaxId: 9606]} eahrvlfgfvpetkeelqvmpgnivfvlkkgndnwatvmfngqkglvpcnylepv
Timeline for d2dmoa1: