Lineage for d2dmoa_ (2dmo A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1536407Protein p67phox [74922] (1 species)
  7. 1536408Species Human (Homo sapiens) [TaxId:9606] [74923] (2 PDB entries)
  8. 1536409Domain d2dmoa_: 2dmo A: [241611]
    automated match to d1ue9a_

Details for d2dmoa_

PDB Entry: 2dmo (more details)

PDB Description: refined solution structure of the 1st sh3 domain from human neutrophil cytosol factor 2 (ncf-2)
PDB Compounds: (A:) neutrophil cytosol factor 2

SCOPe Domain Sequences for d2dmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dmoa_ b.34.2.1 (A:) p67phox {Human (Homo sapiens) [TaxId: 9606]}
gssgssgeahrvlfgfvpetkeelqvmpgnivfvlkkgndnwatvmfngqkglvpcnyle
pvsgpssg

SCOPe Domain Coordinates for d2dmoa_:

Click to download the PDB-style file with coordinates for d2dmoa_.
(The format of our PDB-style files is described here.)

Timeline for d2dmoa_: