SCOPe 2.08: Domain d2dmla1: 2dml A:8-124

Lineage for d2dmla1 (2dml A:8-124)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)

8. Domain d2dmla1: 2dml A:8-124 [241610]
   Other proteins in same PDB: d2dmla2, d2dmla3
   automated match to d3vwwa_

Details for d2dmla1

PDB Entry: 2dml

PDB Description: the solution structure of the first thioredoxin domain of mouse protein disulfide-isomerase a6

PDB Compounds: (A:) Protein disulfide-isomerase A6

SCOPe Domain Sequences for d2dmla1:

Sequence; same for both SEQRES and ATOM records:

>d2dmla1 c.47.1.0 (A:8-124) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avsglysssddvieltpsnfnreviqsdglwlvefyapwcghcqrltpewkkaatalkdv
vkvgavnadkhqslggqygvqgfptikifganknkpedyqggrtgeaivdaalsalr

Timeline for d2dmla1:

• d2dmla1 first appeared in SCOPe 2.04, called d2dmla_
  
• d2dmla1 appears in SCOPe 2.07