SCOPe 2.04: Domain d2dmka_: 2dmk A:

Lineage for d2dmka_ (2dmk A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (27 PDB entries)

8. Domain d2dmka_: 2dmk A: [241609]
   automated match to d1uema_

Details for d2dmka_

PDB Entry: 2dmk

PDB Description: The solution structure of the FN3 domain of human Midline 2 protein

PDB Compounds: (A:) midline 2 isoform 2

SCOPe Domain Sequences for d2dmka_:

Sequence; same for both SEQRES and ATOM records:

>d2dmka_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgegldyltapnppsireelctashdtitvhwisddefsissyelqytiftgqan
fislynsvdswmivpnikqnhytvhglqsgtryifivkainqagsrnseptrlktnsqpf
ksgpssg

Timeline for d2dmka_:

• d2dmka_ is new in SCOPe 2.04-stable
  
• d2dmka_ appears in SCOPe 2.05
  
• d2dmka_ appears in the current release, SCOPe 2.07, called d2dmka1