Lineage for d2dmga1 (2dmg A:8-136)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382506Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2382773Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2382774Protein automated matches [190497] (4 species)
    not a true protein
  7. 2382777Species Human (Homo sapiens) [TaxId:9606] [188711] (25 PDB entries)
  8. 2382812Domain d2dmga1: 2dmg A:8-136 [241608]
    Other proteins in same PDB: d2dmga2, d2dmga3
    automated match to d1rh8a_

Details for d2dmga1

PDB Entry: 2dmg (more details)

PDB Description: solution structure of the third c2 domain of kiaa1228 protein
PDB Compounds: (A:) KIAA1228 protein

SCOPe Domain Sequences for d2dmga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dmga1 b.7.1.0 (A:8-136) automated matches {Human (Homo sapiens) [TaxId: 9606]}
splgqiqltirhssqrnklivvvhacrnliafsedgsdpyvrmyllpdkrrsgrrkthvs
kktlnpvfdqsfdfsvslpevqrrtldvavknsggflskdkgllgkvlvalaseelakgw
tqwydlted

SCOPe Domain Coordinates for d2dmga1:

Click to download the PDB-style file with coordinates for d2dmga1.
(The format of our PDB-style files is described here.)

Timeline for d2dmga1: