SCOPe 2.05: Domain d2dm8a_: 2dm8 A:

Lineage for d2dm8a_ (2dm8 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (84 PDB entries)

8. Domain d2dm8a_: 2dm8 A: [241607]
   automated match to d1wfva_

Details for d2dm8a_

PDB Entry: 2dm8

PDB Description: solution structure of the eighth pdz domain of human inad-like protein

PDB Compounds: (A:) InaD-like protein

SCOPe Domain Sequences for d2dm8a_:

Sequence; same for both SEQRES and ATOM records:

>d2dm8a_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgpatcpivpgqemiieiskgrsglglsivggkdtplnaivihevyeegaaardg
rlwagdqilevngvdlrnssheeaitalrqtpqkvrlvvyrdeahyrdeesgpssg

Timeline for d2dm8a_:

• d2dm8a_ first appeared in SCOPe 2.04
  
• d2dm8a_ is called d2dm8a1 in SCOPe 2.06
  
• d2dm8a_ appears in the current release, SCOPe 2.08, called d2dm8a1