SCOPe 2.05: Domain d2dm2a_: 2dm2 A:

Lineage for d2dm2a_ (2dm2 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2dm2a_: 2dm2 A: [241605]
   automated match to d2yxma_

Details for d2dm2a_

PDB Entry: 2dm2

PDB Description: Solution structure of the first ig domain of human palladin

PDB Compounds: (A:) palladin

SCOPe Domain Sequences for d2dm2a_:

Sequence; same for both SEQRES and ATOM records:

>d2dm2a_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgapffemklkhykifegmpvtftcrvagnpkpkiywfkdgkqispksdhytiqr
dldgtcslhttastldddgnytimaanpqgrisctgrlmvqavnsgpssg

Timeline for d2dm2a_:

• d2dm2a_ first appeared in SCOPe 2.04
  
• d2dm2a_ is called d2dm2a1 in SCOPe 2.06
  
• d2dm2a_ appears in the current release, SCOPe 2.08, called d2dm2a1