Lineage for d2dm1a_ (2dm1 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536554Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1536555Protein automated matches [190457] (8 species)
    not a true protein
  7. 1536598Species Human (Homo sapiens) [TaxId:9606] [187598] (77 PDB entries)
  8. 1536688Domain d2dm1a_: 2dm1 A: [241604]
    automated match to d4esra_

Details for d2dm1a_

PDB Entry: 2dm1 (more details)

PDB Description: solution structure of the second sh3 domain of human protein vav-2
PDB Compounds: (A:) Protein vav-2

SCOPe Domain Sequences for d2dm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dm1a_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssggtavarynfaardmrelslregdvvriysriggdqgwwkgetngrigwfpsty
veeegiqsgpssg

SCOPe Domain Coordinates for d2dm1a_:

Click to download the PDB-style file with coordinates for d2dm1a_.
(The format of our PDB-style files is described here.)

Timeline for d2dm1a_: