Lineage for d2dm0a1 (2dm0 A:8-119)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2572318Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2572319Protein automated matches [190561] (4 species)
    not a true protein
  7. 2572320Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)
  8. 2572512Domain d2dm0a1: 2dm0 A:8-119 [241603]
    Other proteins in same PDB: d2dm0a2, d2dm0a3
    automated match to d1csza_

Details for d2dm0a1

PDB Entry: 2dm0 (more details)

PDB Description: solution structure of the sh2 domain of human tyrosine-protein kinase txk
PDB Compounds: (A:) Tyrosine-protein kinase TXK

SCOPe Domain Sequences for d2dm0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dm0a1 d.93.1.0 (A:8-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkitnleiyewyhrnitrnqaehllrqeskegafivrdsrhlgsytisvfmgarrsteaa
ikhyqikkndsgqwyvaerhafqsipeliwyhqhnaaglmtrlrypvglmgs

SCOPe Domain Coordinates for d2dm0a1:

Click to download the PDB-style file with coordinates for d2dm0a1.
(The format of our PDB-style files is described here.)

Timeline for d2dm0a1: