SCOPe 2.06: Domain d2dlza1: 2dlz A:8-112

Lineage for d2dlza1 (2dlz A:8-112)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (49 PDB entries)

8. Domain d2dlza1: 2dlz A:8-112 [241602]
   Other proteins in same PDB: d2dlza2, d2dlza3
   automated match to d2fcia1

Details for d2dlza1

PDB Entry: 2dlz

PDB Description: solution structure of the sh2 domain of human protein vav-2

PDB Compounds: (A:) Protein vav-2

SCOPe Domain Sequences for d2dlza1:

Sequence; same for both SEQRES and ATOM records:

>d2dlza1 d.93.1.0 (A:8-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sreidytaypwfagnmerqqtdnllkshasgtylirerpaeaerfaisikfndevkhikv
vekdnwihiteakkfdsllelveyyqchslkesfkqldttlkypy

Timeline for d2dlza1:

• d2dlza1 first appeared in SCOPe 2.04, called d2dlza_
  
• d2dlza1 was called d2dlza_ in SCOPe 2.05
  
• d2dlza1 appears in SCOPe 2.07
  
• d2dlza1 appears in the current release, SCOPe 2.08