SCOPe 2.04: Domain d2dlya_: 2dly A:

Lineage for d2dlya_ (2dly A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226265] (3 PDB entries)

8. Domain d2dlya_: 2dly A: [241601]
   automated match to d1csza_

Details for d2dlya_

PDB Entry: 2dly

PDB Description: solution structure of the sh2 domain of murine fyn-related kinase

PDB Compounds: (A:) fyn-related kinase

SCOPe Domain Sequences for d2dlya_:

Sequence; same for both SEQRES and ATOM records:

>d2dlya_ d.93.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgaedrslqaepwffgaikradaekqllysenqtgafliresesqkgdfslsvld
egvvkhyrirrldeggffltrrkvfstlnefvnyytttsdglcvklekpclkiqvsgpss
g

Timeline for d2dlya_:

• d2dlya_ is new in SCOPe 2.04-stable
  
• d2dlya_ appears in SCOPe 2.05
  
• d2dlya_ appears in the current release, SCOPe 2.08, called d2dlya1