Lineage for d1g8wa_ (1g8w A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794082Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 794617Protein Phytohemagglutinin-L, PHA-L, also arcelin [49920] (2 species)
    single-chain subunit has "generic" topology
  7. 794618Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49921] (4 PDB entries)
  8. 794622Domain d1g8wa_: 1g8w A: [24160]

Details for d1g8wa_

PDB Entry: 1g8w (more details), 2.8 Å

PDB Description: improved structure of phytohemagglutinin-l from the kidney bean
PDB Compounds: (A:) leucoagglutinating phytohemagglutinin

SCOP Domain Sequences for d1g8wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
sndiyfnfqrfnetnlilqrdasvsssgqlrltnlngngeprvgslgrafysapiqiwdn
ttgtvasfatsftfniqvpnnagpadglafalvpvgsqpkdkggflglfdgsnsnfhtva
vefdtlynkdwdpterhigidvnsirsikttrwdfvngenaevlitydsstnllvaslvy
psqktsfivsdtvdlksvlpewvsvgfsattginkgnvetndvlswsfaskls

SCOP Domain Coordinates for d1g8wa_:

Click to download the PDB-style file with coordinates for d1g8wa_.
(The format of our PDB-style files is described here.)

Timeline for d1g8wa_: