SCOPe 2.06: Domain d2dlva1: 2dlv A:8-134

Lineage for d2dlva1 (2dlv A:8-134)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries)

8. Domain d2dlva1: 2dlv A:8-134 [241599]
   Other proteins in same PDB: d2dlva2, d2dlva3
   automated match to d4igua_

Details for d2dlva1

PDB Entry: 2dlv

PDB Description: solution structure of the rgs domain of human regulator of g-protein signaling 18

PDB Compounds: (A:) Regulator of G-protein signaling 18

SCOPe Domain Sequences for d2dlva1:

Sequence; same for both SEQRES and ATOM records:

>d2dlva1 a.91.1.0 (A:8-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
speeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqihlka
kaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrflks
diyldlm

Timeline for d2dlva1:

• d2dlva1 first appeared in SCOPe 2.04, called d2dlva_
  
• d2dlva1 was called d2dlva_ in SCOPe 2.05
  
• d2dlva1 appears in SCOPe 2.07
  
• d2dlva1 appears in the current release, SCOPe 2.08