SCOPe 2.04: Domain d2dlva_: 2dlv A:

Lineage for d2dlva_ (2dlv A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries)

8. Domain d2dlva_: 2dlv A: [241599]
   automated match to d4igua_

Details for d2dlva_

PDB Entry: 2dlv

PDB Description: solution structure of the rgs domain of human regulator of g-protein signaling 18

PDB Compounds: (A:) Regulator of G-protein signaling 18

SCOPe Domain Sequences for d2dlva_:

Sequence; same for both SEQRES and ATOM records:

>d2dlva_ a.91.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgp
qqihlkakaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqds
ytrflksdiyldlmsgpssg

Timeline for d2dlva_:

• d2dlva_ is new in SCOPe 2.04-stable
  
• d2dlva_ appears in SCOPe 2.05
  
• d2dlva_ appears in the current release, SCOPe 2.08, called d2dlva1