| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
| Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
| Protein automated matches [190464] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries) |
| Domain d2dlra1: 2dlr A:8-143 [241596] Other proteins in same PDB: d2dlra2, d2dlra3 automated match to d2ihbb_ |
PDB Entry: 2dlr (more details)
SCOPe Domain Sequences for d2dlra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dlra1 a.91.1.0 (A:8-143) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slkstakwaaslenlledpegvkrfreflkkefseenvlfwlacedfkkmqdktqmqeka
keiymtflsskassqvnvegqsrlnekileephplmfqklqdqifnlmkydsysrflksd
lflkhkrteeeeedlp
Timeline for d2dlra1: