SCOPe 2.05: Domain d2dlla_: 2dll A:

Lineage for d2dlla_ (2dll A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186924] (11 PDB entries)

8. Domain d2dlla_: 2dll A: [241594]
   automated match to d1irfa_

Details for d2dlla_

PDB Entry: 2dll

PDB Description: solution structure of the irf domain of human interferon regulator factors 4

PDB Compounds: (A:) Interferon regulatory factor 4

SCOPe Domain Sequences for d2dlla_:

Sequence; same for both SEQRES and ATOM records:

>d2dlla_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgklrqwlidqidsgkypglvweneeksifripwkhagkqdynreedaalfkawa
lfkgkfregidkpdpptwktrlrcalnksndfeelversqldisdpykvyrivpesgpss
g

Timeline for d2dlla_:

• d2dlla_ first appeared in SCOPe 2.04
  
• d2dlla_ is called d2dlla1 in SCOPe 2.06
  
• d2dlla_ appears in the current release, SCOPe 2.08, called d2dlla1