| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Receptor-type tyrosine-protein phosphatase delta, PTPRD [141049] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141050] (2 PDB entries) Uniprot P23468 504-607 |
| Domain d2dlha1: 2dlh A:8-115 [241593] Other proteins in same PDB: d2dlha2, d2dlha3 automated match to d1wj3a_ |
PDB Entry: 2dlh (more details)
SCOPe Domain Sequences for d2dlha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dlha1 b.1.2.1 (A:8-115) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}
pvltqtseqapssaprdvqarmlssttilvqwkepeepngqiqgyrvyytmdptqhvnnw
mkhnvadsqittignlvpqktysvkvlaftsigdgplssdiqvitqtg
Timeline for d2dlha1: