Lineage for d2dlha1 (2dlh A:8-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762103Protein Receptor-type tyrosine-protein phosphatase delta, PTPRD [141049] (1 species)
  7. 2762104Species Human (Homo sapiens) [TaxId:9606] [141050] (2 PDB entries)
    Uniprot P23468 504-607
  8. 2762106Domain d2dlha1: 2dlh A:8-115 [241593]
    Other proteins in same PDB: d2dlha2, d2dlha3
    automated match to d1wj3a_

Details for d2dlha1

PDB Entry: 2dlh (more details)

PDB Description: solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase delta

SCOPe Domain Sequences for d2dlha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlha1 b.1.2.1 (A:8-115) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}
pvltqtseqapssaprdvqarmlssttilvqwkepeepngqiqgyrvyytmdptqhvnnw
mkhnvadsqittignlvpqktysvkvlaftsigdgplssdiqvitqtg

SCOPe Domain Coordinates for d2dlha1:

Click to download the PDB-style file with coordinates for d2dlha1.
(The format of our PDB-style files is described here.)

Timeline for d2dlha1: