Lineage for d2dlcx_ (2dlc X:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255117] (2 PDB entries)
  8. 2106042Domain d2dlcx_: 2dlc X: [241592]
    automated match to d1n3la_
    protein/RNA complex; complexed with mg, ymp

Details for d2dlcx_

PDB Entry: 2dlc (more details), 2.4 Å

PDB Description: crystal structure of the ternary complex of yeast tyrosyl-trna synthetase
PDB Compounds: (X:) Tyrosyl-tRNA synthetase, cytoplasmic

SCOPe Domain Sequences for d2dlcx_:

Sequence, based on SEQRES records: (download)

>d2dlcx_ c.26.1.0 (X:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dpneafglitknlqevlnpqiikdvlevqkrhlklywgtaptgrphcgyfvpmtkladfl
kagcevtvlladlhafldnmkaplevvnyrakyyeltikailrsinvpieklkfvvgssy
qltpdytmdifrlsnivsqndakragadvvkqvanpllsgliyplmqaldeqfldvdcqf
ggvdqrkifvlaeenlpslgykkrahlmnpmvpglaqggkmsasdpnskidlleepkqvk
kkinsafcspgnveengllsfvqyviapiqelkfgtnhfeffidrpekfggpityksfee
mklafkeeklsppdlkigvadainellepirqefannkefqeasekgyp

Sequence, based on observed residues (ATOM records): (download)

>d2dlcx_ c.26.1.0 (X:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dpneafglitknlqevlnpqiikdvlevqkrhlklywgtaptgrphcgyfvpmtkladfl
kagcevtvlladlhafldnmkaplevvnyrakyyeltikailrsinvpieklkfvvgssy
qltpdytmdifrlsnivsqndakragadvvkqvanpllsgliyplmqaldeqfldvdcqf
ggvdqrkifvlaeenlpslgykkrahlmnpmvpglanskidlleepkqvkkkinsafcsp
gnveengllsfvqyviapiqelkfgtnhfeffidrpekfggpityksfeemklafkeekl
sppdlkigvadainellepirqefannkefqeasekgyp

SCOPe Domain Coordinates for d2dlcx_:

Click to download the PDB-style file with coordinates for d2dlcx_.
(The format of our PDB-style files is described here.)

Timeline for d2dlcx_: