Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187598] (90 PDB entries) |
Domain d2dl8a1: 2dl8 A:8-66 [241590] Other proteins in same PDB: d2dl8a2, d2dl8a3 automated match to d1ugva_ |
PDB Entry: 2dl8 (more details)
SCOPe Domain Sequences for d2dl8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dl8a1 b.34.2.0 (A:8-66) automated matches {Human (Homo sapiens) [TaxId: 9606]} epieaiakfdyvgrtarelsfkkgaslllyqrasddwwegrhngidgliphqyivvqdt
Timeline for d2dl8a1: