Lineage for d1avbb_ (1avb B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Phytohemagglutinin-L, PHA-L, also arcelin [49920] (2 species) Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49921] (4 PDB entries) 
Domain d1avbb_: 1avb B: [24159]
Details for d1avbb_
PDB Entry: 1avb (more details), 1.9 Å
PDB Description: arcelin-1 from phaseolus vulgaris l
SCOP Domain Sequences for d1avbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1avbb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris)}
sndasfnvetfnktnlilqgdatvsseghllltnvkgneedsmgrafysapiqindrtid
nlasfstnftfrinakniensayglafalvpvgsrpklkgrylglfnttnydrdahtvav
vfdtvsnrieidvnsirpiatescnfghnngekaevritydspkndlrvsllypsseekc
hvsatvplekevedwvsvgfsatsgskkettethnvlswsfssnfi
SCOP Domain Coordinates for d1avbb_:
Click to download the PDB-style file with coordinates for d1avbb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1avbb_:
- d1avbb_ appears in SCOP 1.57
- d1avbb_ appears in the current release, SCOPe 2.08
View in 3D
