Lineage for d1avbb_ (1avb B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042723Protein Phytohemagglutinin-L, PHA-L, also arcelin [49920] (2 species)
    single-chain subunit has "generic" topology
  7. 2042724Species French bean (Phaseolus vulgaris) [TaxId:3885] [49921] (4 PDB entries)
  8. 2042727Domain d1avbb_: 1avb B: [24159]
    complexed with nag, so4

Details for d1avbb_

PDB Entry: 1avb (more details), 1.9 Å

PDB Description: arcelin-1 from phaseolus vulgaris l
PDB Compounds: (B:) arcelin-1

SCOPe Domain Sequences for d1avbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avbb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {French bean (Phaseolus vulgaris) [TaxId: 3885]}
sndasfnvetfnktnlilqgdatvsseghllltnvkgneedsmgrafysapiqindrtid
nlasfstnftfrinakniensayglafalvpvgsrpklkgrylglfnttnydrdahtvav
vfdtvsnrieidvnsirpiatescnfghnngekaevritydspkndlrvsllypsseekc
hvsatvplekevedwvsvgfsatsgskkettethnvlswsfssnfi

SCOPe Domain Coordinates for d1avbb_:

Click to download the PDB-style file with coordinates for d1avbb_.
(The format of our PDB-style files is described here.)

Timeline for d1avbb_: