SCOPe 2.05: Domain d2dkra_: 2dkr A:

Lineage for d2dkra_ (2dkr A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (84 PDB entries)

8. Domain d2dkra_: 2dkr A: [241584]
   automated match to d1whaa_

Details for d2dkra_

PDB Entry: 2dkr

PDB Description: solution structure of the pdz domain from human lin-7 homolog b

PDB Compounds: (A:) LIN-7 homolog B

SCOPe Domain Sequences for d2dkra_:

Sequence; same for both SEQRES and ATOM records:

>d2dkra_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgvvelpktdeglgfnimggkeqnspiyisrvipggvadrhgglkrgdqllsvng
vsvegeqhekavellkaaqgsvklvvrsgpssg

Timeline for d2dkra_:

• d2dkra_ first appeared in SCOPe 2.04
  
• d2dkra_ is called d2dkra1 in SCOPe 2.06
  
• d2dkra_ appears in the current release, SCOPe 2.08, called d2dkra1