SCOPe 2.04: Domain d2dk9a_: 2dk9 A:

Lineage for d2dk9a_ (2dk9 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (24 PDB entries)

8. Domain d2dk9a_: 2dk9 A: [241581]
   automated match to d1bkra_

Details for d2dk9a_

PDB Entry: 2dk9

PDB Description: solution structure of calponin homology domain of human mical-1

PDB Compounds: (A:) nedd9-interacting protein with calponin homology and lim domains

SCOPe Domain Sequences for d2dk9a_:

Sequence; same for both SEQRES and ATOM records:

>d2dk9a_ a.40.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mghhhhhhmgsagtqeellrwcqeqtagypgvhvsdlssswadglalcalvyrlqpglle
pselqglgaleatawalkvaenelgitpvvsaqavvagsdplgliaylshfhsafksm

Timeline for d2dk9a_:

• d2dk9a_ is new in SCOPe 2.04-stable
  
• d2dk9a_ appears in SCOPe 2.05
  
• d2dk9a_ appears in the current release, SCOPe 2.08, called d2dk9a1