Lineage for d2djqa_ (2djq A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1784036Species Mouse (Mus musculus) [TaxId:10090] [189303] (23 PDB entries)
  8. 1784051Domain d2djqa_: 2djq A: [241579]
    automated match to d1j3ta_

Details for d2djqa_

PDB Entry: 2djq (more details)

PDB Description: The solution structure of the first SH3 domain of mouse SH3 domain containing ring finger 2
PDB Compounds: (A:) SH3 domain containing ring finger 2

SCOPe Domain Sequences for d2djqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2djqa_ b.34.2.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgprakalcnyrgknpgdlkfnkgdvillrrqldenwyqgeingvsgifpassve
visgpssg

SCOPe Domain Coordinates for d2djqa_:

Click to download the PDB-style file with coordinates for d2djqa_.
(The format of our PDB-style files is described here.)

Timeline for d2djqa_: