SCOPe 2.08: Domain d2dila1: 2dil A:8-63

Lineage for d2dila1 (2dil A:8-63)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)

8. Domain d2dila1: 2dil A:8-63 [241570]
   Other proteins in same PDB: d2dila2, d2dila3
   automated match to d1j3ta_

Details for d2dila1

PDB Entry: 2dil

PDB Description: solution structure of the sh3 domain of the human proline-serine- threonine phosphatase-interacting protein 1

PDB Compounds: (A:) Proline-serine-threonine phosphatase-interacting protein 1

SCOPe Domain Sequences for d2dila1:

Sequence; same for both SEQRES and ATOM records:

>d2dila1 b.34.2.0 (A:8-63) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqeyralydytaqnpdeldlsagdilevilegedgwwtverngqrgfvpgsylekl

Timeline for d2dila1:

• d2dila1 first appeared in SCOPe 2.04, called d2dila_
  
• d2dila1 appears in SCOPe 2.07