Lineage for d2dh6a_ (2dh6 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2480954Protein automated matches [190054] (13 species)
    not a true protein
  7. 2480962Species Escherichia coli [TaxId:562] [187621] (3 PDB entries)
  8. 2480965Domain d2dh6a_: 2dh6 A: [241563]
    automated match to d2dh5a_
    complexed with so4

Details for d2dh6a_

PDB Entry: 2dh6 (more details), 3 Å

PDB Description: Crystal structure of E. coli Apo-TrpB
PDB Compounds: (A:) tryptophan synthase beta subunit

SCOPe Domain Sequences for d2dh6a_:

Sequence, based on SEQRES records: (download)

>d2dh6a_ c.79.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
vpqilmpalrqleeafvsaqkdpefqaqfndllknyagrptaltkcqnitagtnttlylk
redllhggahktnqvlgqallakrmgkteiiaetgagqhgvasalasallglkcriymga
kdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsyetahymlgtaagphp
yptivrefqrmigeetkaqileregrlpdaviacvgggsnaigmfadfinetnvgligve
pgghgietgehgaplkhgrvgiyfgmkapmmqtedgqieesysisagldfpsvgpqhayl
nstgradyvsitddealeafktlclhegiipalesshalahalkmmrenpdkeqllvvnl
sgrgdkdiftvhdilkargei

Sequence, based on observed residues (ATOM records): (download)

>d2dh6a_ c.79.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
vpqilmpalrqleeafvsaqkdpefqaqfndllknyagrptaltkcqnitagtnttlylk
redllhggahktnqvlgqallakrmgkteiiaetgagqhgvasalasallglkcriymga
kdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsyetahymlgtaagphp
yptivrefqrmigeetkaqileregrlpdaviacvgggsnaigmfadfinetnvgligve
pgvgpqhaylnstgradyvsitddealeafktlclhegiipalesshalahalkmmrenp
dkeqllvvnlsgrgdkdiftvhdilkargei

SCOPe Domain Coordinates for d2dh6a_:

Click to download the PDB-style file with coordinates for d2dh6a_.
(The format of our PDB-style files is described here.)

Timeline for d2dh6a_: