SCOPe 2.08: Domain d2dgua1: 2dgu A:334-423

Lineage for d2dgua1 (2dgu A:334-423)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)

8. Domain d2dgua1: 2dgu A:334-423 [241561]
   Other proteins in same PDB: d2dgua2, d2dgua3
   automated match to d2cpda1

Details for d2dgua1

PDB Entry: 2dgu

PDB Description: solution structure of the rna binding domain in heterogeneous nuclear ribonucleoprotein q

PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein Q

SCOPe Domain Sequences for d2dgua1:

Sequence; same for both SEQRES and ATOM records:

>d2dgua1 d.58.7.0 (A:334-423) automated matches {Human (Homo sapiens) [TaxId: 9606]}
makvkvlfvrnlantvteeilekafsqfgklervkklkdyafihfderdgavkameemng
kdlegenieivfakppdqkrkerkaqrqaa

Timeline for d2dgua1:

• d2dgua1 first appeared in SCOPe 2.04, called d2dgua_
  
• d2dgua1 appears in SCOPe 2.07