Lineage for d2dgta1 (2dgt A:75-153)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952667Domain d2dgta1: 2dgt A:75-153 [241560]
    Other proteins in same PDB: d2dgta2, d2dgta3
    automated match to d1whwa_

Details for d2dgta1

PDB Entry: 2dgt (more details)

PDB Description: solution structure of the second rna binding domain in rna-binding protein 30
PDB Compounds: (A:) RNA-binding protein 30

SCOPe Domain Sequences for d2dgta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgta1 d.58.7.0 (A:75-153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kastklhvgnisptctnqelrakfeeygpviecdivkdyafvhmeraedaveairgldnt
efqgkrmhvqlstsrlrta

SCOPe Domain Coordinates for d2dgta1:

Click to download the PDB-style file with coordinates for d2dgta1.
(The format of our PDB-style files is described here.)

Timeline for d2dgta1: