Lineage for d1dbnb_ (1dbn B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371405Species Maackia amurensis, leukoagglutinin [TaxId:37501] [49919] (1 PDB entry)
  8. 371407Domain d1dbnb_: 1dbn B: [24156]
    complexed with ca, gal, glc, mn, nag, sia

Details for d1dbnb_

PDB Entry: 1dbn (more details), 2.75 Å

PDB Description: maackia amurensis leukoagglutinin (lectin) with sialyllactose

SCOP Domain Sequences for d1dbnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbnb_ b.29.1.1 (B:) Legume lectin {Maackia amurensis, leukoagglutinin}
sdelsftinnfvpneadllfqgeasvsstgvlqltkvengqpqkysvgralyaapvriwg
nttgsvasfstsftfvvkapnpditsdglafylappdsqipsgsvskylglfnnsnsdss
nqivavefdtyfahsydpwdpnyrhigidvngiesiktvqwdwinggvafatitylapnk
tliaslvypsnqttfsvaasvdlkeilpewvrvgfsaatgyptevethdvlswsftstl

SCOP Domain Coordinates for d1dbnb_:

Click to download the PDB-style file with coordinates for d1dbnb_.
(The format of our PDB-style files is described here.)

Timeline for d1dbnb_: