Lineage for d1dbnb_ (1dbn B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57553Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 57658Protein Legume lectin [49904] (18 species)
  7. 57771Species Maackia amurensis, leukoagglutinin [TaxId:37501] [49919] (1 PDB entry)
  8. 57773Domain d1dbnb_: 1dbn B: [24156]

Details for d1dbnb_

PDB Entry: 1dbn (more details), 2.75 Å

PDB Description: maackia amurensis leukoagglutinin (lectin) with sialyllactose

SCOP Domain Sequences for d1dbnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbnb_ b.29.1.1 (B:) Legume lectin {Maackia amurensis, leukoagglutinin}
sdelsftinnfvpneadllfqgeasvsstgvlqltkvengqpqkysvgralyaapvriwg
nttgsvasfstsftfvvkapnpditsdglafylappdsqipsgsvskylglfnnsnsdss
nqivavefdtyfahsydpwdpnyrhigidvngiesiktvqwdwinggvafatitylapnk
tliaslvypsnqttfsvaasvdlkeilpewvrvgfsaatgyptevethdvlswsftstl

SCOP Domain Coordinates for d1dbnb_:

Click to download the PDB-style file with coordinates for d1dbnb_.
(The format of our PDB-style files is described here.)

Timeline for d1dbnb_: