Lineage for d2dgaa_ (2dga A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083160Species Wheat (Triticum aestivum) [TaxId:4565] [255115] (4 PDB entries)
  8. 2083161Domain d2dgaa_: 2dga A: [241556]
    automated match to d1v08a_
    complexed with gol, so4

Details for d2dgaa_

PDB Entry: 2dga (more details), 1.8 Å

PDB Description: Crystal structure of hexameric beta-glucosidase in wheat
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d2dgaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgaa_ c.1.8.4 (A:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
gpvftklkpwqipkrdwfdkdflfgastsayqiegawnedgkgpstwdhfchtyperisd
mtngdvaansyhlyeedvkalkdmgmkvyrfsiswsrilpdgtgkvnqagidyynklins
lidndivpyvtiwhwdtpqaledkyggflnrqivddykqfaevcfknfgdrvknwftfne
phtyccfsygegihapgrcspgmdcavpegdslrepytaghhillahaeavqlfkarynm
hgdskigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrl
pmftkeeqeklasscdimglnyytsrfskhvdmspdftptlntddayassettgsdgndi
gpitgtywiymypkgltdlllimkekygnppvfitengiadvegdesmpdplddwkrldy
lqrhisavkdaidqgadvrghftwglidnfewslgyssrfglvyidkndgnkrklkksak
wfskfnsvpkp

SCOPe Domain Coordinates for d2dgaa_:

Click to download the PDB-style file with coordinates for d2dgaa_.
(The format of our PDB-style files is described here.)

Timeline for d2dgaa_: