Lineage for d2ddja1 (2ddj A:8-62)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032807Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 3032808Protein automated matches [190829] (14 species)
    not a true protein
  7. 3032850Species Human (Homo sapiens) [TaxId:9606] [188132] (10 PDB entries)
  8. 3032866Domain d2ddja1: 2ddj A:8-62 [241555]
    Other proteins in same PDB: d2ddja2, d2ddja3
    automated match to d1zr0b1

Details for d2ddja1

PDB Entry: 2ddj (more details)

PDB Description: nmr structure of the second kunitz domain of human wfikkn1
PDB Compounds: (A:) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1

SCOPe Domain Sequences for d2ddja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddja1 g.8.1.0 (A:8-62) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dacvlpavqgpcrgweprwayspllqqchpfvyggcegngnnfhsrescedacpv

SCOPe Domain Coordinates for d2ddja1:

Click to download the PDB-style file with coordinates for d2ddja1.
(The format of our PDB-style files is described here.)

Timeline for d2ddja1: