Lineage for d2dclb_ (2dcl B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517841Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2518136Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2518137Protein automated matches [190753] (18 species)
    not a true protein
  7. 2518267Species Pyrococcus horikoshii [TaxId:53953] [255114] (1 PDB entry)
  8. 2518269Domain d2dclb_: 2dcl B: [241552]
    automated match to d1o51a_
    complexed with amp

Details for d2dclb_

PDB Entry: 2dcl (more details), 2.28 Å

PDB Description: Structure of PH1503 protein from Pyrococcus Horikoshii OT3
PDB Compounds: (B:) Hypothetical UPF0166 protein PH1503

SCOPe Domain Sequences for d2dclb_:

Sequence, based on SEQRES records: (download)

>d2dclb_ d.58.5.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
vevehwntlrlriyigendkwegrplykviveklremgiagatvyrgiygfgkksrvhss
dvirlstdlpiivevvdrghniekvvnvikpmikdgmitveptivlwvg

Sequence, based on observed residues (ATOM records): (download)

>d2dclb_ d.58.5.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
vevehwntlrlriyigendkwegrplykviveklremgiagatvyrgiygfgkkstdlpi
ivevvdrghniekvvnvikpmikdgmitveptivlwvg

SCOPe Domain Coordinates for d2dclb_:

Click to download the PDB-style file with coordinates for d2dclb_.
(The format of our PDB-style files is described here.)

Timeline for d2dclb_: